PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009589539.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 220aa    MW: 25746.6 Da    PI: 9.8486
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009589539.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM93.82.8e-29201403128
             NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                      GfrFhPtd elv +yL + v + +l++   i+e d+y+ ePw   k  + +e+ +yfF++ +kk+ +++r  r++ +g Wk++ k k+v+s+kg
  XP_009589539.1  20 EGFRFHPTDTELV-KYLLQYVLKGRLPELIPIEEEDLYSKEPWVVFK--DRKERTLYFFTELKKKKIENSRFIRSVGKGSWKSQDKGKPVCSEKG 111
                     7************.89999999999899889*************962..3467899*************************************** PP

             NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                     +++g k++L + +  +p  +  +W+m+ey+l
  XP_009589539.1 112 SVMGYKRSLRYQNSGSP--QDGQWLMKEYSL 140
                     ***********955444..589*******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.66E-2916168IPR003441NAC domain
PROSITE profilePS5100531.58818168IPR003441NAC domain
PfamPF023651.1E-1720140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MHNIKREEKE LCIENSVHTE GFRFHPTDTE LVKYLLQYVL KGRLPELIPI EEEDLYSKEP  60
WVVFKDRKER TLYFFTELKK KKIENSRFIR SVGKGSWKSQ DKGKPVCSEK GSVMGYKRSL  120
RYQNSGSPQD GQWLMKEYSL TDEVKKILHQ RSRGYDKDNY VLCRVKRKVA KDDPIARKES  180
IEAAELEAIM NPTDGSTKFP NLSIDDVAKL KMRMQFASGK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-202116818168Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016474024.11e-164PREDICTED: NAC domain-containing protein 78-like
TrEMBLM1AA795e-88M1AA79_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000182011e-87(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10241385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46590.11e-20NAC domain containing protein 96